Anti RSF1 pAb (ATL-HPA064567)

Catalog No:
ATL-HPA064567-25
$447.00

Description

Product Description

Protein Description: remodeling and spacing factor 1
Gene Name: RSF1
Alternative Gene Name: HBXAP, p325, RSF-1, XAP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035623: 71%, ENSRNOG00000024194: 63%
Entrez Gene ID: 51773
Uniprot ID: Q96T23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSVTPTKEFLKDEIKQEEETCKRISTITALGHEGKQLVNGEVSDERVAPNFKTEPIETKFYETKEESYSPSKDRNIITEGNGTESLNSVITSMKTGELEK
Gene Sequence KSVTPTKEFLKDEIKQEEETCKRISTITALGHEGKQLVNGEVSDERVAPNFKTEPIETKFYETKEESYSPSKDRNIITEGNGTESLNSVITSMKTGELEK
Gene ID - Mouse ENSMUSG00000035623
Gene ID - Rat ENSRNOG00000024194
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RSF1 pAb (ATL-HPA064567)
Datasheet Anti RSF1 pAb (ATL-HPA064567) Datasheet (External Link)
Vendor Page Anti RSF1 pAb (ATL-HPA064567) at Atlas Antibodies

Documents & Links for Anti RSF1 pAb (ATL-HPA064567)
Datasheet Anti RSF1 pAb (ATL-HPA064567) Datasheet (External Link)
Vendor Page Anti RSF1 pAb (ATL-HPA064567)

Product Description

Protein Description: remodeling and spacing factor 1
Gene Name: RSF1
Alternative Gene Name: HBXAP, p325, RSF-1, XAP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035623: 71%, ENSRNOG00000024194: 63%
Entrez Gene ID: 51773
Uniprot ID: Q96T23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSVTPTKEFLKDEIKQEEETCKRISTITALGHEGKQLVNGEVSDERVAPNFKTEPIETKFYETKEESYSPSKDRNIITEGNGTESLNSVITSMKTGELEK
Gene Sequence KSVTPTKEFLKDEIKQEEETCKRISTITALGHEGKQLVNGEVSDERVAPNFKTEPIETKFYETKEESYSPSKDRNIITEGNGTESLNSVITSMKTGELEK
Gene ID - Mouse ENSMUSG00000035623
Gene ID - Rat ENSRNOG00000024194
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RSF1 pAb (ATL-HPA064567)
Datasheet Anti RSF1 pAb (ATL-HPA064567) Datasheet (External Link)
Vendor Page Anti RSF1 pAb (ATL-HPA064567) at Atlas Antibodies

Documents & Links for Anti RSF1 pAb (ATL-HPA064567)
Datasheet Anti RSF1 pAb (ATL-HPA064567) Datasheet (External Link)
Vendor Page Anti RSF1 pAb (ATL-HPA064567)