Description
Product Description
Protein Description: remodeling and spacing factor 1
Gene Name: RSF1
Alternative Gene Name: HBXAP, p325, RSF-1, XAP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035623: 71%, ENSRNOG00000024194: 63%
Entrez Gene ID: 51773
Uniprot ID: Q96T23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RSF1
Alternative Gene Name: HBXAP, p325, RSF-1, XAP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035623: 71%, ENSRNOG00000024194: 63%
Entrez Gene ID: 51773
Uniprot ID: Q96T23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KSVTPTKEFLKDEIKQEEETCKRISTITALGHEGKQLVNGEVSDERVAPNFKTEPIETKFYETKEESYSPSKDRNIITEGNGTESLNSVITSMKTGELEK |
Gene Sequence | KSVTPTKEFLKDEIKQEEETCKRISTITALGHEGKQLVNGEVSDERVAPNFKTEPIETKFYETKEESYSPSKDRNIITEGNGTESLNSVITSMKTGELEK |
Gene ID - Mouse | ENSMUSG00000035623 |
Gene ID - Rat | ENSRNOG00000024194 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RSF1 pAb (ATL-HPA064567) | |
Datasheet | Anti RSF1 pAb (ATL-HPA064567) Datasheet (External Link) |
Vendor Page | Anti RSF1 pAb (ATL-HPA064567) at Atlas Antibodies |
Documents & Links for Anti RSF1 pAb (ATL-HPA064567) | |
Datasheet | Anti RSF1 pAb (ATL-HPA064567) Datasheet (External Link) |
Vendor Page | Anti RSF1 pAb (ATL-HPA064567) |