Protein Description: round spermatid basic protein 1-like
Gene Name: RSBN1L
Alternative Gene Name: FLJ42526, FLJ45813, MGC71764
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039968: 82%, ENSRNOG00000013431: 84%
Entrez Gene ID: 222194
Uniprot ID: Q6PCB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RSBN1L
Alternative Gene Name: FLJ42526, FLJ45813, MGC71764
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039968: 82%, ENSRNOG00000013431: 84%
Entrez Gene ID: 222194
Uniprot ID: Q6PCB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KRPKMYSKSIQTICSGLLTDVEDQAAKGILNDNIKDYVGKNLDTKNYDSKIPENSEFPFVSLKEPRVQNNLKRLDTLEFKQLIHIEHQPNGGASVIHAYSNELSHLS |
| Gene ID - Mouse | ENSMUSG00000039968 |
| Gene ID - Rat | ENSMUSG00000039968 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RSBN1L pAb (ATL-HPA020406) | |
| Datasheet | Anti RSBN1L pAb (ATL-HPA020406) Datasheet (External Link) |
| Vendor Page | Anti RSBN1L pAb (ATL-HPA020406) at Atlas |
| Documents & Links for Anti RSBN1L pAb (ATL-HPA020406) | |
| Datasheet | Anti RSBN1L pAb (ATL-HPA020406) Datasheet (External Link) |
| Vendor Page | Anti RSBN1L pAb (ATL-HPA020406) |