Anti RRP12 pAb (ATL-HPA074403)

Catalog No:
ATL-HPA074403-25
$447.00

Description

Product Description

Protein Description: ribosomal RNA processing 12 homolog
Gene Name: RRP12
Alternative Gene Name: KIAA0690
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035049: 90%, ENSRNOG00000048495: 88%
Entrez Gene ID: 23223
Uniprot ID: Q5JTH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTYLTITDTQLVNSLLEKASEKVLDPASSDFTRLSVLDLVVALAPCADEAAISKLYSTIRPYLESKAHGVQKKAYRVLEEVCASPQ
Gene Sequence RTYLTITDTQLVNSLLEKASEKVLDPASSDFTRLSVLDLVVALAPCADEAAISKLYSTIRPYLESKAHGVQKKAYRVLEEVCASPQ
Gene ID - Mouse ENSMUSG00000035049
Gene ID - Rat ENSRNOG00000048495
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RRP12 pAb (ATL-HPA074403)
Datasheet Anti RRP12 pAb (ATL-HPA074403) Datasheet (External Link)
Vendor Page Anti RRP12 pAb (ATL-HPA074403) at Atlas Antibodies

Documents & Links for Anti RRP12 pAb (ATL-HPA074403)
Datasheet Anti RRP12 pAb (ATL-HPA074403) Datasheet (External Link)
Vendor Page Anti RRP12 pAb (ATL-HPA074403)

Product Description

Protein Description: ribosomal RNA processing 12 homolog
Gene Name: RRP12
Alternative Gene Name: KIAA0690
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035049: 90%, ENSRNOG00000048495: 88%
Entrez Gene ID: 23223
Uniprot ID: Q5JTH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTYLTITDTQLVNSLLEKASEKVLDPASSDFTRLSVLDLVVALAPCADEAAISKLYSTIRPYLESKAHGVQKKAYRVLEEVCASPQ
Gene Sequence RTYLTITDTQLVNSLLEKASEKVLDPASSDFTRLSVLDLVVALAPCADEAAISKLYSTIRPYLESKAHGVQKKAYRVLEEVCASPQ
Gene ID - Mouse ENSMUSG00000035049
Gene ID - Rat ENSRNOG00000048495
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RRP12 pAb (ATL-HPA074403)
Datasheet Anti RRP12 pAb (ATL-HPA074403) Datasheet (External Link)
Vendor Page Anti RRP12 pAb (ATL-HPA074403) at Atlas Antibodies

Documents & Links for Anti RRP12 pAb (ATL-HPA074403)
Datasheet Anti RRP12 pAb (ATL-HPA074403) Datasheet (External Link)
Vendor Page Anti RRP12 pAb (ATL-HPA074403)