![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101295/181379/atl-hpa074403_anti-rrp12-pab-atl-hpa074403_63047__16659.1681137693.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: ribosomal RNA processing 12 homolog
Gene Name: RRP12
Alternative Gene Name: KIAA0690
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035049: 90%, ENSRNOG00000048495: 88%
Entrez Gene ID: 23223
Uniprot ID: Q5JTH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RRP12
Alternative Gene Name: KIAA0690
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035049: 90%, ENSRNOG00000048495: 88%
Entrez Gene ID: 23223
Uniprot ID: Q5JTH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RTYLTITDTQLVNSLLEKASEKVLDPASSDFTRLSVLDLVVALAPCADEAAISKLYSTIRPYLESKAHGVQKKAYRVLEEVCASPQ |
| Documents & Links for Anti RRP12 pAb (ATL-HPA074403) | |
| Datasheet | Anti RRP12 pAb (ATL-HPA074403) Datasheet (External Link) |
| Vendor Page | Anti RRP12 pAb (ATL-HPA074403) at Atlas |
| Documents & Links for Anti RRP12 pAb (ATL-HPA074403) | |
| Datasheet | Anti RRP12 pAb (ATL-HPA074403) Datasheet (External Link) |
| Vendor Page | Anti RRP12 pAb (ATL-HPA074403) |