Description
Product Description
Protein Description: ribosomal RNA processing 12 homolog
Gene Name: RRP12
Alternative Gene Name: KIAA0690
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035049: 90%, ENSRNOG00000048495: 88%
Entrez Gene ID: 23223
Uniprot ID: Q5JTH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RRP12
Alternative Gene Name: KIAA0690
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035049: 90%, ENSRNOG00000048495: 88%
Entrez Gene ID: 23223
Uniprot ID: Q5JTH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RTYLTITDTQLVNSLLEKASEKVLDPASSDFTRLSVLDLVVALAPCADEAAISKLYSTIRPYLESKAHGVQKKAYRVLEEVCASPQ |
Gene Sequence | RTYLTITDTQLVNSLLEKASEKVLDPASSDFTRLSVLDLVVALAPCADEAAISKLYSTIRPYLESKAHGVQKKAYRVLEEVCASPQ |
Gene ID - Mouse | ENSMUSG00000035049 |
Gene ID - Rat | ENSRNOG00000048495 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RRP12 pAb (ATL-HPA074403) | |
Datasheet | Anti RRP12 pAb (ATL-HPA074403) Datasheet (External Link) |
Vendor Page | Anti RRP12 pAb (ATL-HPA074403) at Atlas Antibodies |
Documents & Links for Anti RRP12 pAb (ATL-HPA074403) | |
Datasheet | Anti RRP12 pAb (ATL-HPA074403) Datasheet (External Link) |
Vendor Page | Anti RRP12 pAb (ATL-HPA074403) |