Description
Product Description
Protein Description: ribonucleotide reductase M1
Gene Name: RRM1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030978: 97%, ENSRNOG00000045752: 96%
Entrez Gene ID: 6240
Uniprot ID: P23921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RRM1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030978: 97%, ENSRNOG00000045752: 96%
Entrez Gene ID: 6240
Uniprot ID: P23921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDR |
Gene Sequence | DKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDR |
Gene ID - Mouse | ENSMUSG00000030978 |
Gene ID - Rat | ENSRNOG00000045752 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RRM1 pAb (ATL-HPA064297) | |
Datasheet | Anti RRM1 pAb (ATL-HPA064297) Datasheet (External Link) |
Vendor Page | Anti RRM1 pAb (ATL-HPA064297) at Atlas Antibodies |
Documents & Links for Anti RRM1 pAb (ATL-HPA064297) | |
Datasheet | Anti RRM1 pAb (ATL-HPA064297) Datasheet (External Link) |
Vendor Page | Anti RRM1 pAb (ATL-HPA064297) |