Anti RRM1 pAb (ATL-HPA064297)

Catalog No:
ATL-HPA064297-25
$395.00

Description

Product Description

Protein Description: ribonucleotide reductase M1
Gene Name: RRM1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030978: 97%, ENSRNOG00000045752: 96%
Entrez Gene ID: 6240
Uniprot ID: P23921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDR
Gene Sequence DKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDR
Gene ID - Mouse ENSMUSG00000030978
Gene ID - Rat ENSRNOG00000045752
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RRM1 pAb (ATL-HPA064297)
Datasheet Anti RRM1 pAb (ATL-HPA064297) Datasheet (External Link)
Vendor Page Anti RRM1 pAb (ATL-HPA064297) at Atlas Antibodies

Documents & Links for Anti RRM1 pAb (ATL-HPA064297)
Datasheet Anti RRM1 pAb (ATL-HPA064297) Datasheet (External Link)
Vendor Page Anti RRM1 pAb (ATL-HPA064297)

Product Description

Protein Description: ribonucleotide reductase M1
Gene Name: RRM1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030978: 97%, ENSRNOG00000045752: 96%
Entrez Gene ID: 6240
Uniprot ID: P23921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDR
Gene Sequence DKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDR
Gene ID - Mouse ENSMUSG00000030978
Gene ID - Rat ENSRNOG00000045752
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RRM1 pAb (ATL-HPA064297)
Datasheet Anti RRM1 pAb (ATL-HPA064297) Datasheet (External Link)
Vendor Page Anti RRM1 pAb (ATL-HPA064297) at Atlas Antibodies

Documents & Links for Anti RRM1 pAb (ATL-HPA064297)
Datasheet Anti RRM1 pAb (ATL-HPA064297) Datasheet (External Link)
Vendor Page Anti RRM1 pAb (ATL-HPA064297)