Description
Product Description
Protein Description: regulatory associated protein of MTOR, complex 1
Gene Name: RPTOR
Alternative Gene Name: KIAA1303, KOG1, Mip1, raptor
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025583: 94%, ENSRNOG00000003821: 94%
Entrez Gene ID: 57521
Uniprot ID: Q8N122
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RPTOR
Alternative Gene Name: KIAA1303, KOG1, Mip1, raptor
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025583: 94%, ENSRNOG00000003821: 94%
Entrez Gene ID: 57521
Uniprot ID: Q8N122
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VSVSVNGDVRIFDPRMPESVNVLQIVKGLTALDIHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSV |
Gene Sequence | VSVSVNGDVRIFDPRMPESVNVLQIVKGLTALDIHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSV |
Gene ID - Mouse | ENSMUSG00000025583 |
Gene ID - Rat | ENSRNOG00000003821 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RPTOR pAb (ATL-HPA064306) | |
Datasheet | Anti RPTOR pAb (ATL-HPA064306) Datasheet (External Link) |
Vendor Page | Anti RPTOR pAb (ATL-HPA064306) at Atlas Antibodies |
Documents & Links for Anti RPTOR pAb (ATL-HPA064306) | |
Datasheet | Anti RPTOR pAb (ATL-HPA064306) Datasheet (External Link) |
Vendor Page | Anti RPTOR pAb (ATL-HPA064306) |