Description
Product Description
Protein Description: ribosomal protein S3
Gene Name: RPS3
Alternative Gene Name: FLJ26283, FLJ27450, MGC87870, S3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030744: 99%, ENSRNOG00000017418: 99%
Entrez Gene ID: 6188
Uniprot ID: P23396
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RPS3
Alternative Gene Name: FLJ26283, FLJ27450, MGC87870, S3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030744: 99%, ENSRNOG00000017418: 99%
Entrez Gene ID: 6188
Uniprot ID: P23396
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPT |
Gene Sequence | NYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPT |
Gene ID - Mouse | ENSMUSG00000030744 |
Gene ID - Rat | ENSRNOG00000017418 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RPS3 pAb (ATL-HPA063339) | |
Datasheet | Anti RPS3 pAb (ATL-HPA063339) Datasheet (External Link) |
Vendor Page | Anti RPS3 pAb (ATL-HPA063339) at Atlas Antibodies |
Documents & Links for Anti RPS3 pAb (ATL-HPA063339) | |
Datasheet | Anti RPS3 pAb (ATL-HPA063339) Datasheet (External Link) |
Vendor Page | Anti RPS3 pAb (ATL-HPA063339) |