![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99067/178479/atl-hpa063339_anti-rps3-pab-atl-hpa063339_60141__35284.1681133931.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue")
Protein Description: ribosomal protein S3
Gene Name: RPS3
Alternative Gene Name: FLJ26283, FLJ27450, MGC87870, S3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030744: 99%, ENSRNOG00000017418: 99%
Entrez Gene ID: 6188
Uniprot ID: P23396
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RPS3
Alternative Gene Name: FLJ26283, FLJ27450, MGC87870, S3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030744: 99%, ENSRNOG00000017418: 99%
Entrez Gene ID: 6188
Uniprot ID: P23396
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPT |
| Documents & Links for Anti RPS3 pAb (ATL-HPA063339) | |
| Datasheet | Anti RPS3 pAb (ATL-HPA063339) Datasheet (External Link) |
| Vendor Page | Anti RPS3 pAb (ATL-HPA063339) at Atlas |
| Documents & Links for Anti RPS3 pAb (ATL-HPA063339) | |
| Datasheet | Anti RPS3 pAb (ATL-HPA063339) Datasheet (External Link) |
| Vendor Page | Anti RPS3 pAb (ATL-HPA063339) |