Anti RPS3 pAb (ATL-HPA063339)

Atlas Antibodies

Catalog No: ATL-HPA063339-100

• 
• 
• 

Product Description

Protein Description: ribosomal protein S3
Gene Name: RPS3
Alternative Gene Name: FLJ26283, FLJ27450, MGC87870, S3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030744: 99%, ENSRNOG00000017418: 99%
Entrez Gene ID: 6188
Uniprot ID: P23396
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPT
• Gene Sequence: NYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPT
• Gene ID - Mouse: ENSMUSG00000030744
• Gene ID - Rat: ENSRNOG00000017418
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.