Protein Description: ribosomal protein S25
Gene Name: RPS25
Alternative Gene Name: S25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009927: 100%, ENSRNOG00000027503: 100%
Entrez Gene ID: 6230
Uniprot ID: P62851
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RPS25
Alternative Gene Name: S25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009927: 100%, ENSRNOG00000027503: 100%
Entrez Gene ID: 6230
Uniprot ID: P62851
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KDDKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKE |
| Documents & Links for Anti RPS25 pAb (ATL-HPA078683) | |
| Datasheet | Anti RPS25 pAb (ATL-HPA078683) Datasheet (External Link) |
| Vendor Page | Anti RPS25 pAb (ATL-HPA078683) at Atlas |
| Documents & Links for Anti RPS25 pAb (ATL-HPA078683) | |
| Datasheet | Anti RPS25 pAb (ATL-HPA078683) Datasheet (External Link) |
| Vendor Page | Anti RPS25 pAb (ATL-HPA078683) |