Protein Description: ribosomal protein S19
Gene Name: RPS19
Alternative Gene Name: DBA, S19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040952: 96%, ENSRNOG00000048199: 96%
Entrez Gene ID: 6223
Uniprot ID: P39019
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RPS19
Alternative Gene Name: DBA, S19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040952: 96%, ENSRNOG00000048199: 96%
Entrez Gene ID: 6223
Uniprot ID: P39019
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQAPEGLKMVEKDQDG |
Documents & Links for Anti RPS19 pAb (ATL-HPA063217) | |
Datasheet | Anti RPS19 pAb (ATL-HPA063217) Datasheet (External Link) |
Vendor Page | Anti RPS19 pAb (ATL-HPA063217) at Atlas |
Documents & Links for Anti RPS19 pAb (ATL-HPA063217) | |
Datasheet | Anti RPS19 pAb (ATL-HPA063217) Datasheet (External Link) |
Vendor Page | Anti RPS19 pAb (ATL-HPA063217) |