Anti RPS16 pAb (ATL-HPA064222)

Atlas Antibodies

Catalog No: ATL-HPA064222-25

• 
• 
• 

Product Description

Protein Description: ribosomal protein S16
Gene Name: RPS16
Alternative Gene Name: S16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037563: 100%, ENSRNOG00000019578: 100%
Entrez Gene ID: 6217
Uniprot ID: P62249
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG
• Gene Sequence: MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG
• Gene ID - Mouse: ENSMUSG00000037563
• Gene ID - Rat: ENSRNOG00000019578
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.