Protein Description: reprimo-like
Gene Name: RPRML
Alternative Gene Name: MGC43894
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046215: 76%, ENSRNOG00000028436: 76%
Entrez Gene ID: 388394
Uniprot ID: Q8N4K4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RPRML
Alternative Gene Name: MGC43894
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046215: 76%, ENSRNOG00000028436: 76%
Entrez Gene ID: 388394
Uniprot ID: Q8N4K4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FLNHSGLEEVDGVGGGAGAAMGNRTHGLGTWLGCCPG |
| Documents & Links for Anti RPRML pAb (ATL-HPA062668) | |
| Datasheet | Anti RPRML pAb (ATL-HPA062668) Datasheet (External Link) |
| Vendor Page | Anti RPRML pAb (ATL-HPA062668) at Atlas |
| Documents & Links for Anti RPRML pAb (ATL-HPA062668) | |
| Datasheet | Anti RPRML pAb (ATL-HPA062668) Datasheet (External Link) |
| Vendor Page | Anti RPRML pAb (ATL-HPA062668) |