Description
Product Description
Protein Description: regulation of nuclear pre-mRNA domain containing 2
Gene Name: RPRD2
Alternative Gene Name: FLJ32145, HSPC099, KIAA0460
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028106: 91%, ENSRNOG00000054294: 94%
Entrez Gene ID: 23248
Uniprot ID: Q5VT52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RPRD2
Alternative Gene Name: FLJ32145, HSPC099, KIAA0460
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028106: 91%, ENSRNOG00000054294: 94%
Entrez Gene ID: 23248
Uniprot ID: Q5VT52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PEESPVPSPSMDAPSPTGSESPFQGMGGEESQSPTMESEKSATPEPVTDNRDVEDMELSDVEDDGSKIIVEDRKEKPAEKSAVSTSVPTKPTENIS |
Gene Sequence | PEESPVPSPSMDAPSPTGSESPFQGMGGEESQSPTMESEKSATPEPVTDNRDVEDMELSDVEDDGSKIIVEDRKEKPAEKSAVSTSVPTKPTENIS |
Gene ID - Mouse | ENSMUSG00000028106 |
Gene ID - Rat | ENSRNOG00000054294 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RPRD2 pAb (ATL-HPA061693) | |
Datasheet | Anti RPRD2 pAb (ATL-HPA061693) Datasheet (External Link) |
Vendor Page | Anti RPRD2 pAb (ATL-HPA061693) at Atlas Antibodies |
Documents & Links for Anti RPRD2 pAb (ATL-HPA061693) | |
Datasheet | Anti RPRD2 pAb (ATL-HPA061693) Datasheet (External Link) |
Vendor Page | Anti RPRD2 pAb (ATL-HPA061693) |