Description
Product Description
Protein Description: ribosomal protein L6
Gene Name: RPL6
Alternative Gene Name: L6, TAXREB107, TXREB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029614: 94%, ENSRNOG00000031889: 94%
Entrez Gene ID: 6128
Uniprot ID: Q02878
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RPL6
Alternative Gene Name: L6, TAXREB107, TXREB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029614: 94%, ENSRNOG00000031889: 94%
Entrez Gene ID: 6128
Uniprot ID: Q02878
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NRVPLRRTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQEGEIF |
Gene Sequence | NRVPLRRTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQEGEIF |
Gene ID - Mouse | ENSMUSG00000029614 |
Gene ID - Rat | ENSRNOG00000031889 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RPL6 pAb (ATL-HPA068418) | |
Datasheet | Anti RPL6 pAb (ATL-HPA068418) Datasheet (External Link) |
Vendor Page | Anti RPL6 pAb (ATL-HPA068418) at Atlas Antibodies |
Documents & Links for Anti RPL6 pAb (ATL-HPA068418) | |
Datasheet | Anti RPL6 pAb (ATL-HPA068418) Datasheet (External Link) |
Vendor Page | Anti RPL6 pAb (ATL-HPA068418) |