Protein Description: ribosomal protein L37a
Gene Name: RPL37A
Alternative Gene Name: L37A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046330: 98%, ENSRNOG00000023385: 96%
Entrez Gene ID: 6168
Uniprot ID: P61513
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RPL37A
Alternative Gene Name: L37A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046330: 98%, ENSRNOG00000023385: 96%
Entrez Gene ID: 6168
Uniprot ID: P61513
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KMKRRAVGIWHCGSCVKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ |
Documents & Links for Anti RPL37A pAb (ATL-HPA065327) | |
Datasheet | Anti RPL37A pAb (ATL-HPA065327) Datasheet (External Link) |
Vendor Page | Anti RPL37A pAb (ATL-HPA065327) at Atlas |
Documents & Links for Anti RPL37A pAb (ATL-HPA065327) | |
Datasheet | Anti RPL37A pAb (ATL-HPA065327) Datasheet (External Link) |
Vendor Page | Anti RPL37A pAb (ATL-HPA065327) |