Protein Description: ribosomal protein L36a
Gene Name: RPL36A
Alternative Gene Name: L36A, RPL44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079435: 100%, ENSRNOG00000011494: 100%
Entrez Gene ID: 6173
Uniprot ID: P83881
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RPL36A
Alternative Gene Name: L36A, RPL44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079435: 100%, ENSRNOG00000011494: 100%
Entrez Gene ID: 6173
Uniprot ID: P83881
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG |
| Documents & Links for Anti RPL36A pAb (ATL-HPA077586) | |
| Datasheet | Anti RPL36A pAb (ATL-HPA077586) Datasheet (External Link) |
| Vendor Page | Anti RPL36A pAb (ATL-HPA077586) at Atlas |
| Documents & Links for Anti RPL36A pAb (ATL-HPA077586) | |
| Datasheet | Anti RPL36A pAb (ATL-HPA077586) Datasheet (External Link) |
| Vendor Page | Anti RPL36A pAb (ATL-HPA077586) |