Protein Description: ribosomal protein L36a
Gene Name: RPL36A
Alternative Gene Name: L36A, RPL44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095693: 37%, ENSRNOG00000014901: 40%
Entrez Gene ID: 6173
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RPL36A
Alternative Gene Name: L36A, RPL44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095693: 37%, ENSRNOG00000014901: 40%
Entrez Gene ID: 6173
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MIAPTDSHEEVRSGTSYILPFASRFLSFRA |
| Documents & Links for Anti RPL36A pAb (ATL-HPA063979) | |
| Datasheet | Anti RPL36A pAb (ATL-HPA063979) Datasheet (External Link) |
| Vendor Page | Anti RPL36A pAb (ATL-HPA063979) at Atlas |
| Documents & Links for Anti RPL36A pAb (ATL-HPA063979) | |
| Datasheet | Anti RPL36A pAb (ATL-HPA063979) Datasheet (External Link) |
| Vendor Page | Anti RPL36A pAb (ATL-HPA063979) |
| Citations for Anti RPL36A pAb (ATL-HPA063979) – 1 Found |
| Zhang, Zhiyuan; Wu, Qi; Fang, Meimiao; Liu, Yu; Jiang, Ji; Feng, Qingyang; Hu, Ronggui; Xu, Jianmin. HERC3 directly targets RPL23A for ubiquitination degradation and further regulates Colorectal Cancer proliferation and the cell cycle. International Journal Of Biological Sciences. 18(8):3282-3297. PubMed |