Description
Product Description
Protein Description: ribosomal protein L11
Gene Name: RPL11
Alternative Gene Name: L11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059291: 100%, ENSRNOG00000026260: 100%
Entrez Gene ID: 6135
Uniprot ID: P62913
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RPL11
Alternative Gene Name: L11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059291: 100%, ENSRNOG00000026260: 100%
Entrez Gene ID: 6135
Uniprot ID: P62913
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAQDQGEKENPMRELRIRKLCLNICVGESGDRLTR |
Gene Sequence | MAQDQGEKENPMRELRIRKLCLNICVGESGDRLTR |
Gene ID - Mouse | ENSMUSG00000059291 |
Gene ID - Rat | ENSRNOG00000026260 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RPL11 pAb (ATL-HPA074839) | |
Datasheet | Anti RPL11 pAb (ATL-HPA074839) Datasheet (External Link) |
Vendor Page | Anti RPL11 pAb (ATL-HPA074839) at Atlas Antibodies |
Documents & Links for Anti RPL11 pAb (ATL-HPA074839) | |
Datasheet | Anti RPL11 pAb (ATL-HPA074839) Datasheet (External Link) |
Vendor Page | Anti RPL11 pAb (ATL-HPA074839) |