Description
Product Description
Protein Description: replication protein A4, 30kDa
Gene Name: RPA4
Alternative Gene Name: HSU24186
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028884: 38%, ENSRNOG00000013005: 41%
Entrez Gene ID: 29935
Uniprot ID: Q13156
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RPA4
Alternative Gene Name: HSU24186
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028884: 38%, ENSRNOG00000013005: 41%
Entrez Gene ID: 29935
Uniprot ID: Q13156
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQV |
Gene Sequence | MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQV |
Gene ID - Mouse | ENSMUSG00000028884 |
Gene ID - Rat | ENSRNOG00000013005 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RPA4 pAb (ATL-HPA066010) | |
Datasheet | Anti RPA4 pAb (ATL-HPA066010) Datasheet (External Link) |
Vendor Page | Anti RPA4 pAb (ATL-HPA066010) at Atlas Antibodies |
Documents & Links for Anti RPA4 pAb (ATL-HPA066010) | |
Datasheet | Anti RPA4 pAb (ATL-HPA066010) Datasheet (External Link) |
Vendor Page | Anti RPA4 pAb (ATL-HPA066010) |