Anti RP11-849H4.2 pAb (ATL-HPA058841)

Atlas Antibodies

Catalog No: ATL-HPA058841-25

• 

Product Description

Protein Description: Putative short transient receptor potential channel 2-like protein
Gene Name: RP11-849H4.2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070425: 90%, ENSRNOG00000019915: 40%
Entrez Gene ID:
Uniprot ID: Q6ZNB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAPVKISHVVSFSSQDPKYPVENLLNPDSPRRPWLGCPQDKSGQLKVELQLERAVPTGYIDVGNCGCAFLQ
• Gene Sequence: MAPVKISHVVSFSSQDPKYPVENLLNPDSPRRPWLGCPQDKSGQLKVELQLERAVPTGYIDVGNCGCAFLQ
• Gene ID - Mouse: ENSMUSG00000070425
• Gene ID - Rat: ENSRNOG00000019915
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.