Description
Product Description
Protein Description:
Gene Name: RP11-302B13.5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025422: 33%, ENSRNOG00000060594: 33%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RP11-302B13.5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025422: 33%, ENSRNOG00000060594: 33%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YKPSSEPLGSPRSSKREPRSLSGTSLTDMSKLSVTGGNPEVLTTGFVEGSRVRS |
Gene Sequence | YKPSSEPLGSPRSSKREPRSLSGTSLTDMSKLSVTGGNPEVLTTGFVEGSRVRS |
Gene ID - Mouse | ENSMUSG00000025422 |
Gene ID - Rat | ENSRNOG00000060594 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RP11-302B13.5 pAb (ATL-HPA068942) | |
Datasheet | Anti RP11-302B13.5 pAb (ATL-HPA068942) Datasheet (External Link) |
Vendor Page | Anti RP11-302B13.5 pAb (ATL-HPA068942) at Atlas Antibodies |
Documents & Links for Anti RP11-302B13.5 pAb (ATL-HPA068942) | |
Datasheet | Anti RP11-302B13.5 pAb (ATL-HPA068942) Datasheet (External Link) |
Vendor Page | Anti RP11-302B13.5 pAb (ATL-HPA068942) |