Anti ROS1 pAb (ATL-HPA049098)

Catalog No:
ATL-HPA049098-25
$395.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: ROS proto-oncogene 1 , receptor tyrosine kinase
Gene Name: ROS1
Alternative Gene Name: c-ros-1, MCF3, ROS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019893: 90%, ENSRNOG00000000406: 87%
Entrez Gene ID: 6098
Uniprot ID: P08922
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WKYNEFYHVKTSCSQGPAYVCNITNLQPYTSYNVRVVVVYKTGENSTSLPESFKTKAGVPNKPGIPKLLEGSKNSIQWEKAEDNGC
Gene Sequence WKYNEFYHVKTSCSQGPAYVCNITNLQPYTSYNVRVVVVYKTGENSTSLPESFKTKAGVPNKPGIPKLLEGSKNSIQWEKAEDNGC
Gene ID - Mouse ENSMUSG00000019893
Gene ID - Rat ENSRNOG00000000406
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti ROS1 pAb (ATL-HPA049098)
Datasheet Anti ROS1 pAb (ATL-HPA049098) Datasheet (External Link)
Vendor Page Anti ROS1 pAb (ATL-HPA049098) at Atlas

Documents & Links for Anti ROS1 pAb (ATL-HPA049098)
Datasheet Anti ROS1 pAb (ATL-HPA049098) Datasheet (External Link)
Vendor Page Anti ROS1 pAb (ATL-HPA049098)