Protein Description: ROS proto-oncogene 1 , receptor tyrosine kinase
Gene Name: ROS1
Alternative Gene Name: c-ros-1, MCF3, ROS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019893: 90%, ENSRNOG00000000406: 87%
Entrez Gene ID: 6098
Uniprot ID: P08922
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ROS1
Alternative Gene Name: c-ros-1, MCF3, ROS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019893: 90%, ENSRNOG00000000406: 87%
Entrez Gene ID: 6098
Uniprot ID: P08922
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WKYNEFYHVKTSCSQGPAYVCNITNLQPYTSYNVRVVVVYKTGENSTSLPESFKTKAGVPNKPGIPKLLEGSKNSIQWEKAEDNGC |
Gene Sequence | WKYNEFYHVKTSCSQGPAYVCNITNLQPYTSYNVRVVVVYKTGENSTSLPESFKTKAGVPNKPGIPKLLEGSKNSIQWEKAEDNGC |
Gene ID - Mouse | ENSMUSG00000019893 |
Gene ID - Rat | ENSRNOG00000000406 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ROS1 pAb (ATL-HPA049098) | |
Datasheet | Anti ROS1 pAb (ATL-HPA049098) Datasheet (External Link) |
Vendor Page | Anti ROS1 pAb (ATL-HPA049098) at Atlas |
Documents & Links for Anti ROS1 pAb (ATL-HPA049098) | |
Datasheet | Anti ROS1 pAb (ATL-HPA049098) Datasheet (External Link) |
Vendor Page | Anti ROS1 pAb (ATL-HPA049098) |