Protein Description: retinal outer segment membrane protein 1
Gene Name: ROM1
Alternative Gene Name: ROM, TSPAN23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071648: 82%, ENSRNOG00000019858: 80%
Entrez Gene ID: 6094
Uniprot ID: Q03395
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ROM1
Alternative Gene Name: ROM, TSPAN23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071648: 82%, ENSRNOG00000019858: 80%
Entrez Gene ID: 6094
Uniprot ID: Q03395
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RYLQTALEGLGGVIDAGGETQGYLFPSGLKDMLKTAWLQGGVACRPAPEEAPPGEAPPKEDLSEA |
Documents & Links for Anti ROM1 pAb (ATL-HPA073279) | |
Datasheet | Anti ROM1 pAb (ATL-HPA073279) Datasheet (External Link) |
Vendor Page | Anti ROM1 pAb (ATL-HPA073279) at Atlas |
Documents & Links for Anti ROM1 pAb (ATL-HPA073279) | |
Datasheet | Anti ROM1 pAb (ATL-HPA073279) Datasheet (External Link) |
Vendor Page | Anti ROM1 pAb (ATL-HPA073279) |