Protein Description: roundabout guidance receptor 4
Gene Name: ROBO4
Alternative Gene Name: ECSM4, FLJ20798, MRB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032125: 81%, ENSRNOG00000050964: 84%
Entrez Gene ID: 54538
Uniprot ID: Q8WZ75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ROBO4
Alternative Gene Name: ECSM4, FLJ20798, MRB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032125: 81%, ENSRNOG00000050964: 84%
Entrez Gene ID: 54538
Uniprot ID: Q8WZ75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PAENHNGIIRGYQVWSLGNTSLPPANWTVVGEQTQLEIATHMPGSYCVQVAAVTGAGAGEPSRPVCLLLEQAMERATQEPSEHGPW |
| Documents & Links for Anti ROBO4 pAb (ATL-HPA065212) | |
| Datasheet | Anti ROBO4 pAb (ATL-HPA065212) Datasheet (External Link) |
| Vendor Page | Anti ROBO4 pAb (ATL-HPA065212) at Atlas |
| Documents & Links for Anti ROBO4 pAb (ATL-HPA065212) | |
| Datasheet | Anti ROBO4 pAb (ATL-HPA065212) Datasheet (External Link) |
| Vendor Page | Anti ROBO4 pAb (ATL-HPA065212) |
| Citations for Anti ROBO4 pAb (ATL-HPA065212) – 1 Found |
| Pircher, Andreas; Schäfer, Georg; Eigentler, Andrea; Pichler, Renate; Puhr, Martin; Steiner, Eberhard; Horninger, Wolfgang; Gunsilius, Eberhard; Klocker, Helmut; Heidegger, Isabel. Robo 4 - the double-edged sword in prostate cancer: impact on cancer cell aggressiveness and tumor vasculature. International Journal Of Medical Sciences. 16(1):115-124. PubMed |