Protein Description: roundabout guidance receptor 1
Gene Name: ROBO1
Alternative Gene Name: DUTT1, FLJ21882, SAX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022883: 97%, ENSRNOG00000029614: 96%
Entrez Gene ID: 6091
Uniprot ID: Q9Y6N7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ROBO1
Alternative Gene Name: DUTT1, FLJ21882, SAX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022883: 97%, ENSRNOG00000029614: 96%
Entrez Gene ID: 6091
Uniprot ID: Q9Y6N7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PNTGNNHNDCSISCCTAGNGNSDSNLTTYSRPADCIANYNNQLDNKQTNLMLPESTVYGDVDLSNKINEMKTFNSPNLKDGRFVNPSGQPTPYATTQLIQSNLSNNMNNGSGD |
| Documents & Links for Anti ROBO1 pAb (ATL-HPA074461) | |
| Datasheet | Anti ROBO1 pAb (ATL-HPA074461) Datasheet (External Link) |
| Vendor Page | Anti ROBO1 pAb (ATL-HPA074461) at Atlas |
| Documents & Links for Anti ROBO1 pAb (ATL-HPA074461) | |
| Datasheet | Anti ROBO1 pAb (ATL-HPA074461) Datasheet (External Link) |
| Vendor Page | Anti ROBO1 pAb (ATL-HPA074461) |