Anti RNFT2 pAb (ATL-HPA064161 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA064161-100

• 
• 
• 

Product Description

Protein Description: ring finger protein, transmembrane 2
Gene Name: RNFT2
Alternative Gene Name: FLJ14627, TMEM118
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032850: 93%, ENSRNOG00000001124: 95%
Entrez Gene ID: 84900
Uniprot ID: Q96EX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPHHHFHHGGHRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGLP
• Gene Sequence: QPHHHFHHGGHRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGLP
• Gene ID - Mouse: ENSMUSG00000032850
• Gene ID - Rat: ENSRNOG00000001124
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.