![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99299/178804/atl-hpa064161_anti-rnft2-pab-atl-hpa064161-wenhanced-validation_60466__45858.1681134364.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp")
Protein Description: ring finger protein, transmembrane 2
Gene Name: RNFT2
Alternative Gene Name: FLJ14627, TMEM118
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032850: 93%, ENSRNOG00000001124: 95%
Entrez Gene ID: 84900
Uniprot ID: Q96EX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RNFT2
Alternative Gene Name: FLJ14627, TMEM118
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032850: 93%, ENSRNOG00000001124: 95%
Entrez Gene ID: 84900
Uniprot ID: Q96EX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QPHHHFHHGGHRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGLP |
| Documents & Links for Anti RNFT2 pAb (ATL-HPA064161 w/enhanced validation) | |
| Datasheet | Anti RNFT2 pAb (ATL-HPA064161 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RNFT2 pAb (ATL-HPA064161 w/enhanced validation) at Atlas |
| Documents & Links for Anti RNFT2 pAb (ATL-HPA064161 w/enhanced validation) | |
| Datasheet | Anti RNFT2 pAb (ATL-HPA064161 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RNFT2 pAb (ATL-HPA064161 w/enhanced validation) |