Protein Description: ring finger protein 8, E3 ubiquitin protein ligase
Gene Name: RNF8
Alternative Gene Name: KIAA0646
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098374: 77%, ENSRNOG00000047171: 78%
Entrez Gene ID: 9025
Uniprot ID: O76064
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RNF8
Alternative Gene Name: KIAA0646
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098374: 77%, ENSRNOG00000047171: 78%
Entrez Gene ID: 9025
Uniprot ID: O76064
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | CEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMI |
Documents & Links for Anti RNF8 pAb (ATL-HPA064925) | |
Datasheet | Anti RNF8 pAb (ATL-HPA064925) Datasheet (External Link) |
Vendor Page | Anti RNF8 pAb (ATL-HPA064925) at Atlas |
Documents & Links for Anti RNF8 pAb (ATL-HPA064925) | |
Datasheet | Anti RNF8 pAb (ATL-HPA064925) Datasheet (External Link) |
Vendor Page | Anti RNF8 pAb (ATL-HPA064925) |