Anti RNF8 pAb (ATL-HPA064925)

Catalog No:
ATL-HPA064925-25
$395.00

Description

Product Description

Protein Description: ring finger protein 8, E3 ubiquitin protein ligase
Gene Name: RNF8
Alternative Gene Name: KIAA0646
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098374: 77%, ENSRNOG00000047171: 78%
Entrez Gene ID: 9025
Uniprot ID: O76064
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMI
Gene Sequence CEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMI
Gene ID - Mouse ENSMUSG00000098374
Gene ID - Rat ENSRNOG00000047171
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RNF8 pAb (ATL-HPA064925)
Datasheet Anti RNF8 pAb (ATL-HPA064925) Datasheet (External Link)
Vendor Page Anti RNF8 pAb (ATL-HPA064925) at Atlas Antibodies

Documents & Links for Anti RNF8 pAb (ATL-HPA064925)
Datasheet Anti RNF8 pAb (ATL-HPA064925) Datasheet (External Link)
Vendor Page Anti RNF8 pAb (ATL-HPA064925)

Product Description

Protein Description: ring finger protein 8, E3 ubiquitin protein ligase
Gene Name: RNF8
Alternative Gene Name: KIAA0646
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098374: 77%, ENSRNOG00000047171: 78%
Entrez Gene ID: 9025
Uniprot ID: O76064
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMI
Gene Sequence CEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMI
Gene ID - Mouse ENSMUSG00000098374
Gene ID - Rat ENSRNOG00000047171
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RNF8 pAb (ATL-HPA064925)
Datasheet Anti RNF8 pAb (ATL-HPA064925) Datasheet (External Link)
Vendor Page Anti RNF8 pAb (ATL-HPA064925) at Atlas Antibodies

Documents & Links for Anti RNF8 pAb (ATL-HPA064925)
Datasheet Anti RNF8 pAb (ATL-HPA064925) Datasheet (External Link)
Vendor Page Anti RNF8 pAb (ATL-HPA064925)