Anti RNF34 pAb (ATL-HPA074151)

Atlas Antibodies

Catalog No: ATL-HPA074151-25

• 
• 

Product Description

Protein Description: ring finger protein 34, E3 ubiquitin protein ligase
Gene Name: RNF34
Alternative Gene Name: FLJ21786, RIF, RIFF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029474: 97%, ENSRNOG00000001331: 97%
Entrez Gene ID: 80196
Uniprot ID: Q969K3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDL
• Gene Sequence: NIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDL
• Gene ID - Mouse: ENSMUSG00000029474
• Gene ID - Rat: ENSRNOG00000001331
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.