Description
Product Description
Protein Description: ring finger protein 34, E3 ubiquitin protein ligase
Gene Name: RNF34
Alternative Gene Name: FLJ21786, RIF, RIFF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029474: 97%, ENSRNOG00000001331: 97%
Entrez Gene ID: 80196
Uniprot ID: Q969K3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RNF34
Alternative Gene Name: FLJ21786, RIF, RIFF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029474: 97%, ENSRNOG00000001331: 97%
Entrez Gene ID: 80196
Uniprot ID: Q969K3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDL |
Gene Sequence | NIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDL |
Gene ID - Mouse | ENSMUSG00000029474 |
Gene ID - Rat | ENSRNOG00000001331 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RNF34 pAb (ATL-HPA074151) | |
Datasheet | Anti RNF34 pAb (ATL-HPA074151) Datasheet (External Link) |
Vendor Page | Anti RNF34 pAb (ATL-HPA074151) at Atlas Antibodies |
Documents & Links for Anti RNF34 pAb (ATL-HPA074151) | |
Datasheet | Anti RNF34 pAb (ATL-HPA074151) Datasheet (External Link) |
Vendor Page | Anti RNF34 pAb (ATL-HPA074151) |