Anti RNF14 pAb (ATL-HPA064746)

Atlas Antibodies

Catalog No: ATL-HPA064746-25

• 
• 

Product Description

Protein Description: ring finger protein 14
Gene Name: RNF14
Alternative Gene Name: ARA54, HFB30, TRIAD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060450: 88%, ENSRNOG00000045637: 85%
Entrez Gene ID: 9604
Uniprot ID: Q9UBS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNL
• Gene Sequence: TQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNL
• Gene ID - Mouse: ENSMUSG00000060450
• Gene ID - Rat: ENSRNOG00000045637
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.