Protein Description: ring finger protein 14
Gene Name: RNF14
Alternative Gene Name: ARA54, HFB30, TRIAD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060450: 88%, ENSRNOG00000045637: 85%
Entrez Gene ID: 9604
Uniprot ID: Q9UBS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RNF14
Alternative Gene Name: ARA54, HFB30, TRIAD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060450: 88%, ENSRNOG00000045637: 85%
Entrez Gene ID: 9604
Uniprot ID: Q9UBS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNL |
Documents & Links for Anti RNF14 pAb (ATL-HPA064746) | |
Datasheet | Anti RNF14 pAb (ATL-HPA064746) Datasheet (External Link) |
Vendor Page | Anti RNF14 pAb (ATL-HPA064746) at Atlas |
Documents & Links for Anti RNF14 pAb (ATL-HPA064746) | |
Datasheet | Anti RNF14 pAb (ATL-HPA064746) Datasheet (External Link) |
Vendor Page | Anti RNF14 pAb (ATL-HPA064746) |