Protein Description: ring finger protein 13
Gene Name: RNF13
Alternative Gene Name: RZF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036503: 97%, ENSRNOG00000029209: 97%
Entrez Gene ID: 11342
Uniprot ID: O43567
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RNF13
Alternative Gene Name: RZF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036503: 97%, ENSRNOG00000029209: 97%
Entrez Gene ID: 11342
Uniprot ID: O43567
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | NASQTFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPVKDNSSGTFIVLIRRLDC |
Documents & Links for Anti RNF13 pAb (ATL-HPA064784) | |
Datasheet | Anti RNF13 pAb (ATL-HPA064784) Datasheet (External Link) |
Vendor Page | Anti RNF13 pAb (ATL-HPA064784) at Atlas |
Documents & Links for Anti RNF13 pAb (ATL-HPA064784) | |
Datasheet | Anti RNF13 pAb (ATL-HPA064784) Datasheet (External Link) |
Vendor Page | Anti RNF13 pAb (ATL-HPA064784) |