Anti RNF123 pAb (ATL-HPA065983)

Atlas Antibodies

Catalog No: ATL-HPA065983-25

• 

Product Description

Protein Description: ring finger protein 123
Gene Name: RNF123
Alternative Gene Name: FLJ12565
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041528: 93%, ENSRNOG00000033378: 92%
Entrez Gene ID: 63891
Uniprot ID: Q5XPI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNMPMLCPPEYMVCFLHRLISALRYYWDEYKASNPHASFSEEAYIPPQVFYNGKVDYFDLQRLGGLLSHLRKTLKDDLASKANIVIDPL
• Gene Sequence: GNMPMLCPPEYMVCFLHRLISALRYYWDEYKASNPHASFSEEAYIPPQVFYNGKVDYFDLQRLGGLLSHLRKTLKDDLASKANIVIDPL
• Gene ID - Mouse: ENSMUSG00000041528
• Gene ID - Rat: ENSRNOG00000033378
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.