Protein Description: ring finger protein 123
Gene Name: RNF123
Alternative Gene Name: FLJ12565
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041528: 93%, ENSRNOG00000033378: 92%
Entrez Gene ID: 63891
Uniprot ID: Q5XPI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RNF123
Alternative Gene Name: FLJ12565
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041528: 93%, ENSRNOG00000033378: 92%
Entrez Gene ID: 63891
Uniprot ID: Q5XPI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GNMPMLCPPEYMVCFLHRLISALRYYWDEYKASNPHASFSEEAYIPPQVFYNGKVDYFDLQRLGGLLSHLRKTLKDDLASKANIVIDPL |
Documents & Links for Anti RNF123 pAb (ATL-HPA065983) | |
Datasheet | Anti RNF123 pAb (ATL-HPA065983) Datasheet (External Link) |
Vendor Page | Anti RNF123 pAb (ATL-HPA065983) at Atlas |
Documents & Links for Anti RNF123 pAb (ATL-HPA065983) | |
Datasheet | Anti RNF123 pAb (ATL-HPA065983) Datasheet (External Link) |
Vendor Page | Anti RNF123 pAb (ATL-HPA065983) |