Protein Description: ring finger protein 115
Gene Name: RNF115
Alternative Gene Name: CL469780, ZNF364
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028098: 90%, ENSRNOG00000000098: 91%
Entrez Gene ID: 27246
Uniprot ID: Q9Y4L5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RNF115
Alternative Gene Name: CL469780, ZNF364
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028098: 90%, ENSRNOG00000000098: 91%
Entrez Gene ID: 27246
Uniprot ID: Q9Y4L5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPEYICPRCESGFIEEVTDDSSFLGGGGSRIDNTTTTHFAELWGHLDHTMFFQDFRPFLSSSPLDQDNRAN |
Gene Sequence | MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPEYICPRCESGFIEEVTDDSSFLGGGGSRIDNTTTTHFAELWGHLDHTMFFQDFRPFLSSSPLDQDNRAN |
Gene ID - Mouse | ENSMUSG00000028098 |
Gene ID - Rat | ENSRNOG00000000098 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti RNF115 pAb (ATL-HPA019130 w/enhanced validation) | |
Datasheet | Anti RNF115 pAb (ATL-HPA019130 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RNF115 pAb (ATL-HPA019130 w/enhanced validation) at Atlas |
Documents & Links for Anti RNF115 pAb (ATL-HPA019130 w/enhanced validation) | |
Datasheet | Anti RNF115 pAb (ATL-HPA019130 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RNF115 pAb (ATL-HPA019130 w/enhanced validation) |