Anti RNF103 pAb (ATL-HPA057922)

Catalog No:
ATL-HPA057922-25
$447.00

Description

Product Description

Protein Description: ring finger protein 103
Gene Name: RNF103
Alternative Gene Name: hkf-1, KF1, ZFP103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052656: 97%, ENSRNOG00000007272: 96%
Entrez Gene ID: 7844
Uniprot ID: O00237
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPVESDWDEDPDLFLERLAFPDLWLHPLIPTDYIKNLPMWRFKCLGVQSE
Gene Sequence YFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPVESDWDEDPDLFLERLAFPDLWLHPLIPTDYIKNLPMWRFKCLGVQSE
Gene ID - Mouse ENSMUSG00000052656
Gene ID - Rat ENSRNOG00000007272
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RNF103 pAb (ATL-HPA057922)
Datasheet Anti RNF103 pAb (ATL-HPA057922) Datasheet (External Link)
Vendor Page Anti RNF103 pAb (ATL-HPA057922) at Atlas Antibodies

Documents & Links for Anti RNF103 pAb (ATL-HPA057922)
Datasheet Anti RNF103 pAb (ATL-HPA057922) Datasheet (External Link)
Vendor Page Anti RNF103 pAb (ATL-HPA057922)

Product Description

Protein Description: ring finger protein 103
Gene Name: RNF103
Alternative Gene Name: hkf-1, KF1, ZFP103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052656: 97%, ENSRNOG00000007272: 96%
Entrez Gene ID: 7844
Uniprot ID: O00237
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPVESDWDEDPDLFLERLAFPDLWLHPLIPTDYIKNLPMWRFKCLGVQSE
Gene Sequence YFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPVESDWDEDPDLFLERLAFPDLWLHPLIPTDYIKNLPMWRFKCLGVQSE
Gene ID - Mouse ENSMUSG00000052656
Gene ID - Rat ENSRNOG00000007272
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RNF103 pAb (ATL-HPA057922)
Datasheet Anti RNF103 pAb (ATL-HPA057922) Datasheet (External Link)
Vendor Page Anti RNF103 pAb (ATL-HPA057922) at Atlas Antibodies

Documents & Links for Anti RNF103 pAb (ATL-HPA057922)
Datasheet Anti RNF103 pAb (ATL-HPA057922) Datasheet (External Link)
Vendor Page Anti RNF103 pAb (ATL-HPA057922)