Description
Product Description
Protein Description: ring finger protein 103
Gene Name: RNF103
Alternative Gene Name: hkf-1, KF1, ZFP103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052656: 97%, ENSRNOG00000007272: 96%
Entrez Gene ID: 7844
Uniprot ID: O00237
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RNF103
Alternative Gene Name: hkf-1, KF1, ZFP103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052656: 97%, ENSRNOG00000007272: 96%
Entrez Gene ID: 7844
Uniprot ID: O00237
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPVESDWDEDPDLFLERLAFPDLWLHPLIPTDYIKNLPMWRFKCLGVQSE |
Gene Sequence | YFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPVESDWDEDPDLFLERLAFPDLWLHPLIPTDYIKNLPMWRFKCLGVQSE |
Gene ID - Mouse | ENSMUSG00000052656 |
Gene ID - Rat | ENSRNOG00000007272 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RNF103 pAb (ATL-HPA057922) | |
Datasheet | Anti RNF103 pAb (ATL-HPA057922) Datasheet (External Link) |
Vendor Page | Anti RNF103 pAb (ATL-HPA057922) at Atlas Antibodies |
Documents & Links for Anti RNF103 pAb (ATL-HPA057922) | |
Datasheet | Anti RNF103 pAb (ATL-HPA057922) Datasheet (External Link) |
Vendor Page | Anti RNF103 pAb (ATL-HPA057922) |