Anti RND2 pAb (ATL-HPA077757)

Catalog No:
ATL-HPA077757-25
$447.00
Protein Description: Rho family GTPase 2
Gene Name: RND2
Alternative Gene Name: ARHN, Rho7, RhoN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001313: 100%, ENSRNOG00000020698: 100%
Entrez Gene ID: 8153
Uniprot ID: P52198
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence GCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDV
Gene ID - Mouse ENSMUSG00000001313
Gene ID - Rat ENSMUSG00000001313
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti RND2 pAb (ATL-HPA077757)
Datasheet Anti RND2 pAb (ATL-HPA077757) Datasheet (External Link)
Vendor Page Anti RND2 pAb (ATL-HPA077757) at Atlas

Documents & Links for Anti RND2 pAb (ATL-HPA077757)
Datasheet Anti RND2 pAb (ATL-HPA077757) Datasheet (External Link)
Vendor Page Anti RND2 pAb (ATL-HPA077757)