Protein Description: Rho family GTPase 2
Gene Name: RND2
Alternative Gene Name: ARHN, Rho7, RhoN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001313: 100%, ENSRNOG00000020698: 100%
Entrez Gene ID: 8153
Uniprot ID: P52198
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RND2
Alternative Gene Name: ARHN, Rho7, RhoN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001313: 100%, ENSRNOG00000020698: 100%
Entrez Gene ID: 8153
Uniprot ID: P52198
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GCKLDMRTDLATLRELSKQRLIPVTHEQGTVLAKQVGAVSYVECSSRSSERSVRDV |
| Documents & Links for Anti RND2 pAb (ATL-HPA077757) | |
| Datasheet | Anti RND2 pAb (ATL-HPA077757) Datasheet (External Link) |
| Vendor Page | Anti RND2 pAb (ATL-HPA077757) at Atlas |
| Documents & Links for Anti RND2 pAb (ATL-HPA077757) | |
| Datasheet | Anti RND2 pAb (ATL-HPA077757) Datasheet (External Link) |
| Vendor Page | Anti RND2 pAb (ATL-HPA077757) |