Protein Description: Rho family GTPase 1
Gene Name: RND1
Alternative Gene Name: ARHS, Rho6, RHOS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054855: 98%, ENSRNOG00000059857: 98%
Entrez Gene ID: 27289
Uniprot ID: Q92730
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RND1
Alternative Gene Name: ARHS, Rho6, RHOS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054855: 98%, ENSRNOG00000059857: 98%
Entrez Gene ID: 27289
Uniprot ID: Q92730
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSI |
| Documents & Links for Anti RND1 pAb (ATL-HPA077800) | |
| Datasheet | Anti RND1 pAb (ATL-HPA077800) Datasheet (External Link) |
| Vendor Page | Anti RND1 pAb (ATL-HPA077800) at Atlas |
| Documents & Links for Anti RND1 pAb (ATL-HPA077800) | |
| Datasheet | Anti RND1 pAb (ATL-HPA077800) Datasheet (External Link) |
| Vendor Page | Anti RND1 pAb (ATL-HPA077800) |
| Citations for Anti RND1 pAb (ATL-HPA077800) – 1 Found |
| Kumar, Akhilesh; Mishra, Shalabh; Kumar, Ashish; Raut, Ashwin Ashok; Sato, Seiichi; Takaoka, Akinori; Kumar, Himanshu. Essential role of Rnd1 in innate immunity during viral and bacterial infections. Cell Death & Disease. 2022;13(6):520. PubMed |