![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99839/179524/atl-hpa066509_anti-rnaset2-pab-atl-hpa066509_61186__45674.1681135237.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma")
Protein Description: ribonuclease T2
Gene Name: RNASET2
Alternative Gene Name: bA514O12.3, FLJ10907, RNASE6PL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094724: 62%, ENSRNOG00000013190: 60%
Entrez Gene ID: 8635
Uniprot ID: O00584
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RNASET2
Alternative Gene Name: bA514O12.3, FLJ10907, RNASE6PL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094724: 62%, ENSRNOG00000013190: 60%
Entrez Gene ID: 8635
Uniprot ID: O00584
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYP |
| Documents & Links for Anti RNASET2 pAb (ATL-HPA066509) | |
| Datasheet | Anti RNASET2 pAb (ATL-HPA066509) Datasheet (External Link) |
| Vendor Page | Anti RNASET2 pAb (ATL-HPA066509) at Atlas |
| Documents & Links for Anti RNASET2 pAb (ATL-HPA066509) | |
| Datasheet | Anti RNASET2 pAb (ATL-HPA066509) Datasheet (External Link) |
| Vendor Page | Anti RNASET2 pAb (ATL-HPA066509) |