![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/1280x1280/products/101369/181463/atl-hpa074840_anti-rmdn3-pab-atl-hpa074840_63131__80762.1681137796.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101369/181463/atl-hpa074840_anti-rmdn3-pab-atl-hpa074840_63131__80762.1681137796.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: regulator of microtubule dynamics 3
Gene Name: RMDN3
Alternative Gene Name: FAM82A2, FAM82C, FLJ10579, PTPIP51, RMD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070730: 80%, ENSRNOG00000011690: 83%
Entrez Gene ID: 55177
Uniprot ID: Q96TC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RMDN3
Alternative Gene Name: FAM82A2, FAM82C, FLJ10579, PTPIP51, RMD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070730: 80%, ENSRNOG00000011690: 83%
Entrez Gene ID: 55177
Uniprot ID: Q96TC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SQRWKRTQRHGRSQSLPNSLDYTQTSDPGRHVMLLRAVPGGAGDASVLPSLPREGQEKVLDRLDFVLTSLVALRREVEELRSSLRGLAGEIVGE |
| Documents & Links for Anti RMDN3 pAb (ATL-HPA074840) | |
| Datasheet | Anti RMDN3 pAb (ATL-HPA074840) Datasheet (External Link) |
| Vendor Page | Anti RMDN3 pAb (ATL-HPA074840) at Atlas |
| Documents & Links for Anti RMDN3 pAb (ATL-HPA074840) | |
| Datasheet | Anti RMDN3 pAb (ATL-HPA074840) Datasheet (External Link) |
| Vendor Page | Anti RMDN3 pAb (ATL-HPA074840) |