Anti RIOK2 pAb (ATL-HPA005681)

Atlas

Catalog No: ATL-HPA005681-25

• 
• 

Protein Description: RIO kinase 2
Gene Name: RIOK2
Alternative Gene Name: FLJ11159
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023852: 66%, ENSRNOG00000012692: 67%
Entrez Gene ID: 55781
Uniprot ID: Q9BVS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FPTFKDIRREDTLDVEVSASGYTKEMQADDELLHPLGPDDKNIETKEGSEFSFSDGEVAEKAEVYRSENESERNCLEESEGCYCRSSGDPEQIKEDSLSEESADARSFE
• Gene Sequence: FPTFKDIRREDTLDVEVSASGYTKEMQADDELLHPLGPDDKNIETKEGSEFSFSDGEVAEKAEVYRSENESERNCLEESEGCYCRSSGDPEQIKEDSLSEESADARSFE
• Gene ID - Mouse: ENSMUSG00000023852
• Gene ID - Rat: ENSRNOG00000012692
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RIOK2 pAb (ATL-HPA005681) – 2 Found

Yu, Min; Hu, Xiaoyan; Yan, Jingyu; Wang, Ying; Lu, Fei; Chang, Junlei. RIOK2 Inhibitor NSC139021 Exerts Anti-Tumor Effects on Glioblastoma via Inducing Skp2-Mediated Cell Cycle Arrest and Apoptosis. Biomedicines. 2021;9(9) 

Matsuzaki, Yusuke; Naito, Yutaka; Miura, Nami; Mori, Taisuke; Watabe, Yukio; Yoshimoto, Seiichi; Shibahara, Takahiko; Takano, Masayuki; Honda, Kazufumi. RIOK2 Contributes to Cell Growth and Protein Synthesis in Human Oral Squamous Cell Carcinoma. Current Oncology (Toronto, Ont.). 2022;30(1):381-391.