Polyclonal Antibody against Human RIN3, Gene description: Ras and Rab interactor 3, Alternative Gene Names: FLJ22439, Validated applications: IHC, Uniprot ID: Q8TB24, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QTSSTEMLQEIRTMMTQLKSYLLQSTELKALVDPALHSEEELEAIVESALYKCVLKPLKEAINSCLHQIHSKDGSLQQLKENQ |
Gene ID - Mouse | ENSMUSG00000044456 |
Gene ID - Rat | ENSMUSG00000044456 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti-RIN3 pAb (ATL-HPA079218) | |
Vendor Page | Anti-RIN3 pAb (ATL-HPA079218) at Atlas |
Documents & Links for Anti-RIN3 pAb (ATL-HPA079218) | |
Vendor Page | Anti-RIN3 pAb (ATL-HPA079218) |