Polyclonal Antibody against Human RIN3, Gene description: Ras and Rab interactor 3, Alternative Gene Names: FLJ22439, Validated applications: IHC, Uniprot ID: Q8TB24, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QTSSTEMLQEIRTMMTQLKSYLLQSTELKALVDPALHSEEELEAIVESALYKCVLKPLKEAINSCLHQIHSKDGSLQQLKENQ |
| Gene ID - Mouse | ENSMUSG00000044456 |
| Gene ID - Rat | ENSMUSG00000044456 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti-RIN3 pAb (ATL-HPA079218) | |
| Vendor Page | Anti-RIN3 pAb (ATL-HPA079218) at Atlas |
| Documents & Links for Anti-RIN3 pAb (ATL-HPA079218) | |
| Vendor Page | Anti-RIN3 pAb (ATL-HPA079218) |