Anti-RIN3 pAb (ATL-HPA079218)

Atlas Antibodies

Catalog No:
ATL-HPA079218-100
$596.00
Polyclonal Antibody against Human RIN3, Gene description: Ras and Rab interactor 3, Alternative Gene Names: FLJ22439, Validated applications: IHC, Uniprot ID: Q8TB24, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence QTSSTEMLQEIRTMMTQLKSYLLQSTELKALVDPALHSEEELEAIVESALYKCVLKPLKEAINSCLHQIHSKDGSLQQLKENQ
Gene ID - Mouse ENSMUSG00000044456
Gene ID - Rat ENSMUSG00000044456
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti-RIN3 pAb (ATL-HPA079218)
Vendor Page Anti-RIN3 pAb (ATL-HPA079218) at Atlas

Documents & Links for Anti-RIN3 pAb (ATL-HPA079218)
Vendor Page Anti-RIN3 pAb (ATL-HPA079218)