Protein Description: RIC3 acetylcholine receptor chaperone
Gene Name: RIC3
Alternative Gene Name: AYST720, FLJ11608, PRO1385
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048330: 88%, ENSRNOG00000014691: 89%
Entrez Gene ID: 79608
Uniprot ID: Q7Z5B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RIC3
Alternative Gene Name: AYST720, FLJ11608, PRO1385
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048330: 88%, ENSRNOG00000014691: 89%
Entrez Gene ID: 79608
Uniprot ID: Q7Z5B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LSKGKTTAEDGKCYTAMPGNTHRKITSFELAQLQEKLKETEAAMEKLINRVGPNGERAQTVTSDQEKRLLHQLREITRVM |
| Documents & Links for Anti RIC3 pAb (ATL-HPA065016) | |
| Datasheet | Anti RIC3 pAb (ATL-HPA065016) Datasheet (External Link) |
| Vendor Page | Anti RIC3 pAb (ATL-HPA065016) at Atlas |
| Documents & Links for Anti RIC3 pAb (ATL-HPA065016) | |
| Datasheet | Anti RIC3 pAb (ATL-HPA065016) Datasheet (External Link) |
| Vendor Page | Anti RIC3 pAb (ATL-HPA065016) |