Anti RIC3 pAb (ATL-HPA065016)

Catalog No:
ATL-HPA065016-25
$303.00

Description

Product Description

Protein Description: RIC3 acetylcholine receptor chaperone
Gene Name: RIC3
Alternative Gene Name: AYST720, FLJ11608, PRO1385
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048330: 88%, ENSRNOG00000014691: 89%
Entrez Gene ID: 79608
Uniprot ID: Q7Z5B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSKGKTTAEDGKCYTAMPGNTHRKITSFELAQLQEKLKETEAAMEKLINRVGPNGERAQTVTSDQEKRLLHQLREITRVM
Gene Sequence LSKGKTTAEDGKCYTAMPGNTHRKITSFELAQLQEKLKETEAAMEKLINRVGPNGERAQTVTSDQEKRLLHQLREITRVM
Gene ID - Mouse ENSMUSG00000048330
Gene ID - Rat ENSRNOG00000014691
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RIC3 pAb (ATL-HPA065016)
Datasheet Anti RIC3 pAb (ATL-HPA065016) Datasheet (External Link)
Vendor Page Anti RIC3 pAb (ATL-HPA065016) at Atlas Antibodies

Documents & Links for Anti RIC3 pAb (ATL-HPA065016)
Datasheet Anti RIC3 pAb (ATL-HPA065016) Datasheet (External Link)
Vendor Page Anti RIC3 pAb (ATL-HPA065016)

Product Description

Protein Description: RIC3 acetylcholine receptor chaperone
Gene Name: RIC3
Alternative Gene Name: AYST720, FLJ11608, PRO1385
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048330: 88%, ENSRNOG00000014691: 89%
Entrez Gene ID: 79608
Uniprot ID: Q7Z5B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSKGKTTAEDGKCYTAMPGNTHRKITSFELAQLQEKLKETEAAMEKLINRVGPNGERAQTVTSDQEKRLLHQLREITRVM
Gene Sequence LSKGKTTAEDGKCYTAMPGNTHRKITSFELAQLQEKLKETEAAMEKLINRVGPNGERAQTVTSDQEKRLLHQLREITRVM
Gene ID - Mouse ENSMUSG00000048330
Gene ID - Rat ENSRNOG00000014691
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RIC3 pAb (ATL-HPA065016)
Datasheet Anti RIC3 pAb (ATL-HPA065016) Datasheet (External Link)
Vendor Page Anti RIC3 pAb (ATL-HPA065016) at Atlas Antibodies

Documents & Links for Anti RIC3 pAb (ATL-HPA065016)
Datasheet Anti RIC3 pAb (ATL-HPA065016) Datasheet (External Link)
Vendor Page Anti RIC3 pAb (ATL-HPA065016)