Anti RHOH pAb (ATL-HPA061314)

Atlas Antibodies

Catalog No: ATL-HPA061314-25

• 
• 

Product Description

Protein Description: ras homolog family member H
Gene Name: RHOH
Alternative Gene Name: ARHH, RhoH, TTF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029204: 100%, ENSRNOG00000002540: 99%
Entrez Gene ID: 399
Uniprot ID: Q15669
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKN
• Gene Sequence: VRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKN
• Gene ID - Mouse: ENSMUSG00000029204
• Gene ID - Rat: ENSRNOG00000002540
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.