Protein Description: ras homolog family member F, filopodia associated
Gene Name: RHOF
Alternative Gene Name: ARHF, FLJ20247, RIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029449: 95%, ENSRNOG00000042607: 95%
Entrez Gene ID: 54509
Uniprot ID: Q9HBH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RHOF
Alternative Gene Name: ARHF, FLJ20247, RIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029449: 95%, ENSRNOG00000042607: 95%
Entrez Gene ID: 54509
Uniprot ID: Q9HBH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYD |
Documents & Links for Anti RHOF pAb (ATL-HPA076019 w/enhanced validation) | |
Datasheet | Anti RHOF pAb (ATL-HPA076019 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RHOF pAb (ATL-HPA076019 w/enhanced validation) at Atlas |
Documents & Links for Anti RHOF pAb (ATL-HPA076019 w/enhanced validation) | |
Datasheet | Anti RHOF pAb (ATL-HPA076019 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RHOF pAb (ATL-HPA076019 w/enhanced validation) |