Anti RHOF pAb (ATL-HPA076019 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA076019-25

• 

Product Description

Protein Description: ras homolog family member F, filopodia associated
Gene Name: RHOF
Alternative Gene Name: ARHF, FLJ20247, RIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029449: 95%, ENSRNOG00000042607: 95%
Entrez Gene ID: 54509
Uniprot ID: Q9HBH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYD
• Gene Sequence: LLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYD
• Gene ID - Mouse: ENSMUSG00000029449
• Gene ID - Rat: ENSRNOG00000042607
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.