Protein Description: regulator of G-protein signaling 20
Gene Name: RGS20
Alternative Gene Name: RGSZ1, ZGAP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002459: 47%, ENSRNOG00000003388: 30%
Entrez Gene ID: 8601
Uniprot ID: O76081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RGS20
Alternative Gene Name: RGSZ1, ZGAP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002459: 47%, ENSRNOG00000003388: 30%
Entrez Gene ID: 8601
Uniprot ID: O76081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MPQLSQDNQECLQKHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVP |
Documents & Links for Anti RGS20 pAb (ATL-HPA070193 w/enhanced validation) | |
Datasheet | Anti RGS20 pAb (ATL-HPA070193 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RGS20 pAb (ATL-HPA070193 w/enhanced validation) at Atlas |
Documents & Links for Anti RGS20 pAb (ATL-HPA070193 w/enhanced validation) | |
Datasheet | Anti RGS20 pAb (ATL-HPA070193 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RGS20 pAb (ATL-HPA070193 w/enhanced validation) |