Anti RGS19 pAb (ATL-HPA056384)

Atlas Antibodies

Catalog No: ATL-HPA056384-25

• 

Product Description

Protein Description: regulator of G-protein signaling 19
Gene Name: RGS19
Alternative Gene Name: GAIP, RGSGAIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002458: 86%, ENSRNOG00000016547: 86%
Entrez Gene ID: 10287
Uniprot ID: P49795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCC
• Gene Sequence: PHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCC
• Gene ID - Mouse: ENSMUSG00000002458
• Gene ID - Rat: ENSRNOG00000016547
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.