Protein Description: regulator of G protein signaling 13
Gene Name: RGS13
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051079: 84%, ENSRNOG00000003888: 83%
Entrez Gene ID: 6003
Uniprot ID: O14921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RGS13
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051079: 84%, ENSRNOG00000003888: 83%
Entrez Gene ID: 6003
Uniprot ID: O14921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK |
Documents & Links for Anti RGS13 pAb (ATL-HPA076656 w/enhanced validation) | |
Datasheet | Anti RGS13 pAb (ATL-HPA076656 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RGS13 pAb (ATL-HPA076656 w/enhanced validation) at Atlas |
Documents & Links for Anti RGS13 pAb (ATL-HPA076656 w/enhanced validation) | |
Datasheet | Anti RGS13 pAb (ATL-HPA076656 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RGS13 pAb (ATL-HPA076656 w/enhanced validation) |