Anti RGS12 pAb (ATL-HPA067421)

Atlas Antibodies

Catalog No: ATL-HPA067421-25

• 

Product Description

Protein Description: regulator of G-protein signaling 12
Gene Name: RGS12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029101: 96%, ENSRNOG00000030568: 96%
Entrez Gene ID: 6002
Uniprot ID: O14924
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GYLGSIELPSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCVQLSTDKAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTND
• Gene Sequence: GYLGSIELPSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCVQLSTDKAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTND
• Gene ID - Mouse: ENSMUSG00000029101
• Gene ID - Rat: ENSRNOG00000030568
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.