Anti RGS12 pAb (ATL-HPA067421)

Catalog No:
ATL-HPA067421-25
$401.00
Protein Description: regulator of G-protein signaling 12
Gene Name: RGS12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029101: 96%, ENSRNOG00000030568: 96%
Entrez Gene ID: 6002
Uniprot ID: O14924
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence GYLGSIELPSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCVQLSTDKAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTND

Documents & Links for Anti RGS12 pAb (ATL-HPA067421)
Datasheet Anti RGS12 pAb (ATL-HPA067421) Datasheet (External Link)
Vendor Page Anti RGS12 pAb (ATL-HPA067421) at Atlas

Documents & Links for Anti RGS12 pAb (ATL-HPA067421)
Datasheet Anti RGS12 pAb (ATL-HPA067421) Datasheet (External Link)
Vendor Page Anti RGS12 pAb (ATL-HPA067421)