Protein Description: regulator of G-protein signaling 12
Gene Name: RGS12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029101: 96%, ENSRNOG00000030568: 96%
Entrez Gene ID: 6002
Uniprot ID: O14924
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RGS12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029101: 96%, ENSRNOG00000030568: 96%
Entrez Gene ID: 6002
Uniprot ID: O14924
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GYLGSIELPSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCVQLSTDKAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTND |
Documents & Links for Anti RGS12 pAb (ATL-HPA067421) | |
Datasheet | Anti RGS12 pAb (ATL-HPA067421) Datasheet (External Link) |
Vendor Page | Anti RGS12 pAb (ATL-HPA067421) at Atlas |
Documents & Links for Anti RGS12 pAb (ATL-HPA067421) | |
Datasheet | Anti RGS12 pAb (ATL-HPA067421) Datasheet (External Link) |
Vendor Page | Anti RGS12 pAb (ATL-HPA067421) |