Protein Description: ring finger and WD repeat domain 3
Gene Name: RFWD3
Alternative Gene Name: FLJ10520, RNF201
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033596: 60%, ENSRNOG00000024632: 26%
Entrez Gene ID: 55159
Uniprot ID: Q6PCD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RFWD3
Alternative Gene Name: FLJ10520, RNF201
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033596: 60%, ENSRNOG00000024632: 26%
Entrez Gene ID: 55159
Uniprot ID: Q6PCD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NHTIPASSLHSMTNFISGLQRLHGMLEFLRPSSSNHSVGPMRTRRRVSASRRARAGGSQRTDSARLRAPLDAYFQVSRTQPDLPATTYDSETRNPVSE |
| Documents & Links for Anti RFWD3 pAb (ATL-HPA075649) | |
| Datasheet | Anti RFWD3 pAb (ATL-HPA075649) Datasheet (External Link) |
| Vendor Page | Anti RFWD3 pAb (ATL-HPA075649) at Atlas |
| Documents & Links for Anti RFWD3 pAb (ATL-HPA075649) | |
| Datasheet | Anti RFWD3 pAb (ATL-HPA075649) Datasheet (External Link) |
| Vendor Page | Anti RFWD3 pAb (ATL-HPA075649) |