Description
Product Description
Protein Description: ring finger and WD repeat domain 3
Gene Name: RFWD3
Alternative Gene Name: FLJ10520, RNF201
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033596: 60%, ENSRNOG00000024632: 26%
Entrez Gene ID: 55159
Uniprot ID: Q6PCD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RFWD3
Alternative Gene Name: FLJ10520, RNF201
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033596: 60%, ENSRNOG00000024632: 26%
Entrez Gene ID: 55159
Uniprot ID: Q6PCD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NHTIPASSLHSMTNFISGLQRLHGMLEFLRPSSSNHSVGPMRTRRRVSASRRARAGGSQRTDSARLRAPLDAYFQVSRTQPDLPATTYDSETRNPVSE |
Gene Sequence | NHTIPASSLHSMTNFISGLQRLHGMLEFLRPSSSNHSVGPMRTRRRVSASRRARAGGSQRTDSARLRAPLDAYFQVSRTQPDLPATTYDSETRNPVSE |
Gene ID - Mouse | ENSMUSG00000033596 |
Gene ID - Rat | ENSRNOG00000024632 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RFWD3 pAb (ATL-HPA075649) | |
Datasheet | Anti RFWD3 pAb (ATL-HPA075649) Datasheet (External Link) |
Vendor Page | Anti RFWD3 pAb (ATL-HPA075649) at Atlas Antibodies |
Documents & Links for Anti RFWD3 pAb (ATL-HPA075649) | |
Datasheet | Anti RFWD3 pAb (ATL-HPA075649) Datasheet (External Link) |
Vendor Page | Anti RFWD3 pAb (ATL-HPA075649) |