Description
Product Description
Protein Description: refilin A
Gene Name: RFLNA
Alternative Gene Name: Cfm2, FAM101A, FLJ44614, RefilinA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037962: 79%, ENSRNOG00000001011: 79%
Entrez Gene ID: 144347
Uniprot ID: Q6ZTI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RFLNA
Alternative Gene Name: Cfm2, FAM101A, FLJ44614, RefilinA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037962: 79%, ENSRNOG00000001011: 79%
Entrez Gene ID: 144347
Uniprot ID: Q6ZTI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FFGESIKVNPEPTHEIRCNSEVKYASEKHFQDKVFYAPVPTITAYSETIVAAPNCTWRNYRSQLTLEPRPRALRFRSTTIIFPKHARSTFRTTLHCSLGRPSRWFTASVQLQLCQDP |
Gene Sequence | FFGESIKVNPEPTHEIRCNSEVKYASEKHFQDKVFYAPVPTITAYSETIVAAPNCTWRNYRSQLTLEPRPRALRFRSTTIIFPKHARSTFRTTLHCSLGRPSRWFTASVQLQLCQDP |
Gene ID - Mouse | ENSMUSG00000037962 |
Gene ID - Rat | ENSRNOG00000001011 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RFLNA pAb (ATL-HPA058911) | |
Datasheet | Anti RFLNA pAb (ATL-HPA058911) Datasheet (External Link) |
Vendor Page | Anti RFLNA pAb (ATL-HPA058911) at Atlas Antibodies |
Documents & Links for Anti RFLNA pAb (ATL-HPA058911) | |
Datasheet | Anti RFLNA pAb (ATL-HPA058911) Datasheet (External Link) |
Vendor Page | Anti RFLNA pAb (ATL-HPA058911) |