Description
Product Description
Protein Description: replication factor C (activator 1) 1, 145kDa
Gene Name: RFC1
Alternative Gene Name: A1, MHCBFB, PO-GA, RFC140
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029191: 98%, ENSRNOG00000002855: 98%
Entrez Gene ID: 5981
Uniprot ID: P35251
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RFC1
Alternative Gene Name: A1, MHCBFB, PO-GA, RFC140
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029191: 98%, ENSRNOG00000002855: 98%
Entrez Gene ID: 5981
Uniprot ID: P35251
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LIMDEVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEII |
Gene Sequence | LIMDEVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEII |
Gene ID - Mouse | ENSMUSG00000029191 |
Gene ID - Rat | ENSRNOG00000002855 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RFC1 pAb (ATL-HPA069306) | |
Datasheet | Anti RFC1 pAb (ATL-HPA069306) Datasheet (External Link) |
Vendor Page | Anti RFC1 pAb (ATL-HPA069306) at Atlas Antibodies |
Documents & Links for Anti RFC1 pAb (ATL-HPA069306) | |
Datasheet | Anti RFC1 pAb (ATL-HPA069306) Datasheet (External Link) |
Vendor Page | Anti RFC1 pAb (ATL-HPA069306) |