Anti REV3L pAb (ATL-HPA069382)

Catalog No:
ATL-HPA069382-25
$303.00

Description

Product Description

Protein Description: REV3-like, polymerase (DNA directed), zeta, catalytic subunit
Gene Name: REV3L
Alternative Gene Name: POLZ, REV3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019841: 99%, ENSRNOG00000000593: 95%
Entrez Gene ID: 5980
Uniprot ID: O60673
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHGIFPYLYVPYDGYGQQPESYLSQMAFSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKERHFMKIYLYNPTMVKRICE
Gene Sequence LHGIFPYLYVPYDGYGQQPESYLSQMAFSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKERHFMKIYLYNPTMVKRICE
Gene ID - Mouse ENSMUSG00000019841
Gene ID - Rat ENSRNOG00000000593
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti REV3L pAb (ATL-HPA069382)
Datasheet Anti REV3L pAb (ATL-HPA069382) Datasheet (External Link)
Vendor Page Anti REV3L pAb (ATL-HPA069382) at Atlas Antibodies

Documents & Links for Anti REV3L pAb (ATL-HPA069382)
Datasheet Anti REV3L pAb (ATL-HPA069382) Datasheet (External Link)
Vendor Page Anti REV3L pAb (ATL-HPA069382)

Product Description

Protein Description: REV3-like, polymerase (DNA directed), zeta, catalytic subunit
Gene Name: REV3L
Alternative Gene Name: POLZ, REV3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019841: 99%, ENSRNOG00000000593: 95%
Entrez Gene ID: 5980
Uniprot ID: O60673
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHGIFPYLYVPYDGYGQQPESYLSQMAFSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKERHFMKIYLYNPTMVKRICE
Gene Sequence LHGIFPYLYVPYDGYGQQPESYLSQMAFSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKERHFMKIYLYNPTMVKRICE
Gene ID - Mouse ENSMUSG00000019841
Gene ID - Rat ENSRNOG00000000593
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti REV3L pAb (ATL-HPA069382)
Datasheet Anti REV3L pAb (ATL-HPA069382) Datasheet (External Link)
Vendor Page Anti REV3L pAb (ATL-HPA069382) at Atlas Antibodies

Documents & Links for Anti REV3L pAb (ATL-HPA069382)
Datasheet Anti REV3L pAb (ATL-HPA069382) Datasheet (External Link)
Vendor Page Anti REV3L pAb (ATL-HPA069382)