Protein Description: REV3-like, polymerase (DNA directed), zeta, catalytic subunit
Gene Name: REV3L
Alternative Gene Name: POLZ, REV3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019841: 99%, ENSRNOG00000000593: 95%
Entrez Gene ID: 5980
Uniprot ID: O60673
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: REV3L
Alternative Gene Name: POLZ, REV3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019841: 99%, ENSRNOG00000000593: 95%
Entrez Gene ID: 5980
Uniprot ID: O60673
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LHGIFPYLYVPYDGYGQQPESYLSQMAFSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKERHFMKIYLYNPTMVKRICE |
Documents & Links for Anti REV3L pAb (ATL-HPA069382) | |
Datasheet | Anti REV3L pAb (ATL-HPA069382) Datasheet (External Link) |
Vendor Page | Anti REV3L pAb (ATL-HPA069382) at Atlas |
Documents & Links for Anti REV3L pAb (ATL-HPA069382) | |
Datasheet | Anti REV3L pAb (ATL-HPA069382) Datasheet (External Link) |
Vendor Page | Anti REV3L pAb (ATL-HPA069382) |