Description
Product Description
Protein Description: RELT tumor necrosis factor receptor
Gene Name: RELT
Alternative Gene Name: FLJ14993, TNFRSF19L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008318: 92%, ENSRNOG00000025075: 86%
Entrez Gene ID: 84957
Uniprot ID: Q969Z4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RELT
Alternative Gene Name: FLJ14993, TNFRSF19L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008318: 92%, ENSRNOG00000025075: 86%
Entrez Gene ID: 84957
Uniprot ID: Q969Z4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TSSMVSEVKTITEAGPSWGDLPDSPQPGLPPEQQALLGSGGSRTKWLKPPAENKAEENRYVVRLSE |
Gene Sequence | TSSMVSEVKTITEAGPSWGDLPDSPQPGLPPEQQALLGSGGSRTKWLKPPAENKAEENRYVVRLSE |
Gene ID - Mouse | ENSMUSG00000008318 |
Gene ID - Rat | ENSRNOG00000025075 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RELT pAb (ATL-HPA071518) | |
Datasheet | Anti RELT pAb (ATL-HPA071518) Datasheet (External Link) |
Vendor Page | Anti RELT pAb (ATL-HPA071518) at Atlas Antibodies |
Documents & Links for Anti RELT pAb (ATL-HPA071518) | |
Datasheet | Anti RELT pAb (ATL-HPA071518) Datasheet (External Link) |
Vendor Page | Anti RELT pAb (ATL-HPA071518) |