Description
Product Description
Protein Description: reelin
Gene Name: RELN
Alternative Gene Name: PRO1598, RL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042453: 97%, ENSRNOG00000021441: 96%
Entrez Gene ID: 5649
Uniprot ID: P78509
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RELN
Alternative Gene Name: PRO1598, RL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042453: 97%, ENSRNOG00000021441: 96%
Entrez Gene ID: 5649
Uniprot ID: P78509
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QYSNDNGILWHLLRELDFMSFLEPQIISIDLPQDAKTPATAFRWWQPQHGKHSAQWALDDVLIGMNDSSQTGFQDKFDGSIDLQANWYRIQGGQVDIDCL |
Gene Sequence | QYSNDNGILWHLLRELDFMSFLEPQIISIDLPQDAKTPATAFRWWQPQHGKHSAQWALDDVLIGMNDSSQTGFQDKFDGSIDLQANWYRIQGGQVDIDCL |
Gene ID - Mouse | ENSMUSG00000042453 |
Gene ID - Rat | ENSRNOG00000021441 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RELN pAb (ATL-HPA077891) | |
Datasheet | Anti RELN pAb (ATL-HPA077891) Datasheet (External Link) |
Vendor Page | Anti RELN pAb (ATL-HPA077891) at Atlas Antibodies |
Documents & Links for Anti RELN pAb (ATL-HPA077891) | |
Datasheet | Anti RELN pAb (ATL-HPA077891) Datasheet (External Link) |
Vendor Page | Anti RELN pAb (ATL-HPA077891) |